PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.A00362.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Whirly
Protein Properties Length: 230aa    MW: 25318 Da    PI: 10.289
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.A00362.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly185.21.1e-57541912139
          Whirly   2 vyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkv 96 
                     v+k+kaal++++++p+f++++sg  +++r+G+++l++ +a+++rkyd+ kkq fals+tev++l++l++ +sceffhdp++k+s+eG+v+k+l++
  Pahal.A00362.1  54 VFKGKAALSIHPILPSFSKMESGGSRMNRNGSVMLTFFPAVGQRKYDYTKKQLFALSPTEVGSLISLGPADSCEFFHDPSMKSSHEGQVKKSLSI 148
                     9********************************************************************************************** PP

          Whirly  97 ePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                      Pl   sG+fvn++v n+l+k+ +++svP++kaefav+r++l+
  Pahal.A00362.1 149 TPLGSDSGYFVNITVLNNLQKTTDRLSVPITKAEFAVMRTALS 191
                     ****************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.102.6E-7242207IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544472.59E-7145229IPR009044ssDNA-binding transcriptional regulator
PfamPF085361.3E-5754188IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005739Cellular Componentmitochondrion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MLRLSRFLPP ASRRGFDLKE PLWSGSLTFQ QAVSTSAGNL DENLSGKKFA SYTVFKGKAA  60
LSIHPILPSF SKMESGGSRM NRNGSVMLTF FPAVGQRKYD YTKKQLFALS PTEVGSLISL  120
GPADSCEFFH DPSMKSSHEG QVKKSLSITP LGSDSGYFVN ITVLNNLQKT TDRLSVPITK  180
AEFAVMRTAL SFALPHIMGW DQVLTHHPAP LTSSKPRVER PHPDSEWER*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3n1h_A2e-75462089170StWhy2
3n1i_A2e-75462089170protein StWhy2
3n1j_A2e-75462089170Protein StWhy2
3n1k_A2e-75462089170protein StWhy2
3n1l_A2e-75462089170protein StWhy2
4kop_A2e-75452068169Single-stranded DNA-binding protein WHY2, mit
4kop_B2e-75452068169Single-stranded DNA-binding protein WHY2, mit
4kop_C2e-75452068169Single-stranded DNA-binding protein WHY2, mit
4kop_D2e-75452068169Single-stranded DNA-binding protein WHY2, mit
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9634570.0EU963457.1 Zea mays clone 262942 DNA binding protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951836.11e-158PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial
SwissprotD9J0342e-80WHY2_SOLTU; Single-stranded DNA-bindig protein WHY2, mitochondrial
TrEMBLK3YVJ41e-149K3YVJ4_SETIT; Uncharacterized protein
STRINGSi018290m1e-149(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30123885
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.18e-77WHIRLY 2